Henan Sigma Audley New Material Technology Co., Ltd.
Injection Retatrutide Weight Loss Peptide Tirze Semag 5mg 10mg
We have International raw powder, finished oil, finished tablets, peptides. Welcome to send an inquiry to get more information.
Product Description
What is Trize/Sema/Retatrutide ?
Tirze was developed as a dual agonist to both and gastric inhibitory polypeptide (GIP) receptors (Frias et al., 2018). Similar to , GIP is an incretin hormone that functions to induce secretion.
Tirze is used with a proper diet and exercise program to control high blood sugar in people with type 2 diabetes. Controlling high blood sugar helps prevent kidney damage, blindness, nerve problems, loss of limbs, and sexual function problems.
Sema is a polypeptide that contains a linear sequence of 31 amino acids joined together by peptide linkages. It is an agonist of glucagon-like peptide 1 receptors and used for the treatment of type 2 diabetes.
It has a role as a hypoglycemic agent, a glucagon-like peptide-1 receptor agonist, an anti-obesity agent, a neuroprotective agent and an appetite depressant. It is a polypeptide and a lipopeptide.
Retatrutide is an investigational single molecule that activates the body's receptors for three hormones - glucagon, glucose-dependent insulinotropic polypeptide (GIP), and glucagon-like peptide-1 , and is being studied for the treatment of obesity.
It employs a triple-agonist (triple-G) mechanism of action. In addition to being a it also targets gastric inhibitory polypeptide receptor (GIPR), and glucagon receptor (GCGR). This has consequently shown increased efficacy benefits in clinical trials, superior to those seen with W, which facilitates around -15% body weight loss.
You may also like:
Product details
English name |
Teriparatide Acetate |
Cas number |
52232-67-4 |
Synonyms |
PARATHYROID HORMONE HUMAN: FRAGMENT 1-34;PARATHYROID HORMONE (HUMAN, 1-34);PARATHYROID HORMONE (1-34), HUMAN;PTH (1-34) (HUMAN);PTH (HUMAN, 1-34);Teriparatide acetate;SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF;SER-VAL-SER-GLU-ILE-GLN-LEU-MET-HIS-ASN-LEU-GLY-LYS-HIS-LEU-ASN-SER-MET-GLU-ARG-VAL-GLU-TRP-LEU-ARG-LYS-LYS-LEU-GLN-ASP-VAL-HIS-ASN-PHE |
Purity |
99% |
delivery |
8-12days |
Delivery time |
Next day of payment |
Mode of transport |
Sea, air and truck transport |
Express delivery |
EMS,UPS,FedEx,DHL,TNT |
USES:A fragment of human parathyroid hormone (hPTH) peptide sequence containing the 34 N-terminal residues of hPTH. This fragment was also found to be an agonist at PTH1 and PTH2 receptors.
Our Advantages
Has warehouses in several countries, supports self-pickup, 2-3 days delivery
Double clearance protection
Packaging & Shipping
Packing
Shipping
Company Profile
Henan Sigma Audley New Material Technology Co., Ltd.
-After more than ten years of development since its establishment, the company has established a good reputation in the fields of analysis, chemistry, and medicine. Its products and services involve scientific research, culture and education, agriculture, forestry and environmental protection, inspection and quarantine, petrochemical industry, and bioengineering., medical pharmaceuticals, and food and beverage industries, the production varieties include general and special categories. The company pays attention to consolidating its internal strength, attracts a group of professional management, marketing and scientific and technological talents, and establishes a modern enterprise management system.
Certifications
FAQ
1. Are you a manufacturer or trading company?
A: We are a manufacturer and welcome to visit our factory.
2. How to confirm the product quality before placing an order?
A: We can provide you with the sample. Also, we have the inspection report issued by the authoritative third-party testing agency.
3: What's your MOQ?
A: It depends on different products. We accept sample orders. Also for some products, we can provide you with a free sample.
4:Do you provide after-sales service?
A: We provide 24-hour customer service. If you encounter any product quality problems or transportation problems, please feel free to contact us.
5:How about delivery time and method?
A: We usually ship within 3-5 working days after payments.
We can make ships by sea, air, and express. Also can make door-to-door shipping.
6:How to solve the after-sale disputes?
A: We accept changing or refunding services if there is any quality problem.