• Janoshik 3rd Labtedting Wholesale Tirz Tire Sema Reatrutide Teriparatide Acetate CAS 52232-67-4
  • Janoshik 3rd Labtedting Wholesale Tirz Tire Sema Reatrutide Teriparatide Acetate CAS 52232-67-4
  • Janoshik 3rd Labtedting Wholesale Tirz Tire Sema Reatrutide Teriparatide Acetate CAS 52232-67-4
  • Janoshik 3rd Labtedting Wholesale Tirz Tire Sema Reatrutide Teriparatide Acetate CAS 52232-67-4
  • Janoshik 3rd Labtedting Wholesale Tirz Tire Sema Reatrutide Teriparatide Acetate CAS 52232-67-4
  • Janoshik 3rd Labtedting Wholesale Tirz Tire Sema Reatrutide Teriparatide Acetate CAS 52232-67-4

Janoshik 3rd Labtedting Wholesale Tirz Tire Sema Reatrutide Teriparatide Acetate CAS 52232-67-4

CAS No.: 52232-67-4
Formula: C172h278n52o47s2
EINECS: 640-978-1
Variety: Dye
Feature: Stocked
Usage: Organic Chemical Material
Customization:
Diamond Member Since 2023

Suppliers with verified business licenses

Manufacturer/Factory, Trading Company
  • Overview
  • Product Description
  • Product details
  • Our Advantages
  • Packaging & Shipping
  • Company Profile
  • Certifications
  • FAQ
Overview

Basic Info.

Model NO.
52232-67-4
Status
Solid State
Product Name
Teriparatide Acetate
Form
Powder
Delivery Time
8-12days
Payment Method
Btc, Usdt, Wu, Bank Transfer, Paypal
Transport Package
Box
Trademark
Sigma Audley
Origin
China
HS Code
9001100001
Production Capacity
10tons/Month

Product Description

Henan Sigma Audley New Material Technology Co., Ltd. 
 
Janoshik 3rd Labtedting Wholesale Tirz Tire Sema Reatrutide Teriparatide Acetate CAS 52232-67-4
 Injection Retatrutide Weight Loss Peptide Tirze Semag 5mg 10mg 

We have International raw powder, finished oil,  finished tablets, peptides. Welcome to send an inquiry to get more information. 
Janoshik 3rd Labtedting Wholesale Tirz Tire Sema Reatrutide Teriparatide Acetate CAS 52232-67-4
Product Description

What is Trize/Sema/Retatrutide ?
 

Janoshik 3rd Labtedting Wholesale Tirz Tire Sema Reatrutide Teriparatide Acetate CAS 52232-67-4
Tirze  was developed as a dual agonist to both  and gastric inhibitory polypeptide (GIP) receptors (Frias et al., 2018). Similar to , GIP is an incretin hormone that functions to induce secretion.

Tirze is used with a proper diet and exercise program to control high blood sugar in people with type 2 diabetes.  Controlling high blood sugar helps prevent kidney damage, blindness,  nerve problems, loss of limbs, and sexual function problems.
 
Janoshik 3rd Labtedting Wholesale Tirz Tire Sema Reatrutide Teriparatide Acetate CAS 52232-67-4
Sema  is a polypeptide that contains a linear sequence of 31 amino acids joined together by peptide linkages. It is an agonist of glucagon-like peptide 1 receptors  and used for the treatment of type 2 diabetes. 

It has a role as a hypoglycemic agent, a glucagon-like peptide-1 receptor agonist, an anti-obesity agent, a neuroprotective agent and an appetite depressant. It is a polypeptide and a lipopeptide.
 
Janoshik 3rd Labtedting Wholesale Tirz Tire Sema Reatrutide Teriparatide Acetate CAS 52232-67-4
Retatrutide  is an investigational single molecule that activates the body's receptors for three hormones - glucagon, glucose-dependent insulinotropic polypeptide (GIP), and glucagon-like peptide-1 , and is being studied for the treatment of obesity.

It employs a triple-agonist (triple-G) mechanism of action. In addition to being a  it also targets gastric inhibitory polypeptide receptor (GIPR), and glucagon receptor (GCGR). This has consequently shown increased efficacy benefits in clinical trials, superior to those seen with W, which facilitates around -15% body weight loss.

You may also like:

 

Janoshik 3rd Labtedting Wholesale Tirz Tire Sema Reatrutide Teriparatide Acetate CAS 52232-67-4
Janoshik 3rd Labtedting Wholesale Tirz Tire Sema Reatrutide Teriparatide Acetate CAS 52232-67-4

 

Product details
English name Teriparatide Acetate
Cas number 52232-67-4
Synonyms PARATHYROID HORMONE HUMAN: FRAGMENT 1-34;PARATHYROID HORMONE (HUMAN, 1-34);PARATHYROID HORMONE (1-34), HUMAN;PTH (1-34) (HUMAN);PTH (HUMAN, 1-34);Teriparatide acetate;SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF;SER-VAL-SER-GLU-ILE-GLN-LEU-MET-HIS-ASN-LEU-GLY-LYS-HIS-LEU-ASN-SER-MET-GLU-ARG-VAL-GLU-TRP-LEU-ARG-LYS-LYS-LEU-GLN-ASP-VAL-HIS-ASN-PHE
Purity 99%
delivery 8-12days
Delivery time Next day of payment
Mode of transport Sea, air and truck transport
Express delivery EMS,UPS,FedEx,DHL,TNT
 
 USES:A fragment of human parathyroid hormone (hPTH) peptide sequence containing the 34 N-terminal residues of hPTH. This fragment was also found to be an agonist at PTH1 and PTH2 receptors.
Our Advantages

Has warehouses in several countries, supports self-pickup, 2-3 days delivery

Janoshik 3rd Labtedting Wholesale Tirz Tire Sema Reatrutide Teriparatide Acetate CAS 52232-67-4
Double clearance protection

Janoshik 3rd Labtedting Wholesale Tirz Tire Sema Reatrutide Teriparatide Acetate CAS 52232-67-4
Packaging & Shipping

Packing

Janoshik 3rd Labtedting Wholesale Tirz Tire Sema Reatrutide Teriparatide Acetate CAS 52232-67-4

Shipping
Janoshik 3rd Labtedting Wholesale Tirz Tire Sema Reatrutide Teriparatide Acetate CAS 52232-67-4

Janoshik 3rd Labtedting Wholesale Tirz Tire Sema Reatrutide Teriparatide Acetate CAS 52232-67-4
Company Profile
Janoshik 3rd Labtedting Wholesale Tirz Tire Sema Reatrutide Teriparatide Acetate CAS 52232-67-4
Henan Sigma Audley New Material Technology Co., Ltd.

 -After more than ten years of development since its establishment, the company has established a good reputation in the fields of analysis, chemistry, and medicine. Its products and services involve scientific research, culture and education, agriculture, forestry and environmental protection, inspection and quarantine, petrochemical industry, and bioengineering., medical pharmaceuticals, and food and beverage industries, the production varieties include general and special categories. The company pays attention to consolidating its internal strength, attracts a group of professional management, marketing and scientific and technological talents, and establishes a modern enterprise management system. 
Certifications

Janoshik 3rd Labtedting Wholesale Tirz Tire Sema Reatrutide Teriparatide Acetate CAS 52232-67-4

FAQ

1. Are you a manufacturer or trading company?
A: We are a manufacturer and welcome to visit our factory.
 
2. How to confirm the product quality before placing an order?
A: We can provide you with the sample. Also, we have the inspection report issued by the authoritative third-party testing agency.
 
3: What's your MOQ?
A:  It depends on different products. We accept sample orders. Also for some products, we can provide you with a free sample.
 
4:Do you provide after-sales service?
A: We provide 24-hour customer service. If you encounter any product quality problems or transportation problems, please feel free to contact us.
 
5:How about delivery time and method?
A: We usually ship within 3-5 working days after payments. 
We can make ships by sea, air, and express. Also can make door-to-door shipping. 
 
6:How to solve the after-sale disputes?
A: We accept changing or refunding services if there is any quality problem. 

Send your message to this supplier

*From:
*To:
*Message:

Enter between 20 to 4,000 characters.

This is not what you are looking for? Post a Sourcing Request Now

You Might Also Like

Diamond Member Since 2023

Suppliers with verified business licenses

Manufacturer/Factory, Trading Company
Registered Capital
5000000 RMB
Plant Area
101~500 square meters